VIMSS10093607 has 848 amino acids
Query: GIP1_N [M=60]
Accession: PF06972.15
Description: GBF-interacting protein 1 N-terminal
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.7e-33 100.3 4.6 4.7e-33 99.5 4.6 1.4 1 VIMSS10093607
Domain annotation for each sequence (and alignments):
>> VIMSS10093607
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 99.5 4.6 4.7e-33 4.7e-33 3 60 .] 17 74 .. 15 74 .. 0.97
Alignments for each domain:
== domain 1 score: 99.5 bits; conditional E-value: 4.7e-33
GIP1_N 3 asvrkviqsikEivgkhsdeeiyamLkecnmDpneavqkLLsqDtFheVkskrdkkKE 60
++++k+iqsikE+v hsd++iy++Lke+nmD+neav+kL++qD+FheVk+krd+kKE
VIMSS10093607 17 DEAKKMIQSIKEVVDSHSDADIYTALKEANMDANEAVEKLIHQDPFHEVKRKRDRKKE 74
689******************************************************9 PP
Or compare VIMSS10093607 to CDD or PaperBLAST