WP_007920905.1 has 86 amino acids
Query: DUF1315 [M=82]
Accession: PF07023.16
Description: Protein of unknown function (DUF1315)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.4e-31 92.6 0.1 7.3e-31 92.5 0.1 1.0 1 WP_007920905.1
Domain annotation for each sequence (and alignments):
>> WP_007920905.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 92.5 0.1 7.3e-31 7.3e-31 2 62 .. 6 66 .. 5 77 .. 0.92
Alignments for each domain:
== domain 1 score: 92.5 bits; conditional E-value: 7.3e-31
DUF1315 2 qllasltpdvyqklkrAvEiGkWpdGsrlTeeQRelcmqAViiyeakhlpeeervGyikrk 62
++++++tpd+yq+lk AvEiGkW dG++lT+eQRel++qA i++e ++lpee+r+Gy+ +
WP_007920905.1 6 EMIENITPDIYQSLKLAVEIGKWSDGRKLTAEQRELSLQAMIAWEMQNLPEEQRTGYMGPQ 66
79*******************************************************9654 PP
Or compare WP_007920905.1 to CDD or PaperBLAST