PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS7739166 to PF07027 (DUF1318)

VIMSS7739166 has 108 amino acids

Query:       DUF1318  [M=92]
Accession:   PF07027.16
Description: Protein of unknown function (DUF1318)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    3.5e-32   97.2   0.3    3.9e-32   97.0   0.3    1.0  1  VIMSS7739166  


Domain annotation for each sequence (and alignments):
>> VIMSS7739166  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   97.0   0.3   3.9e-32   3.9e-32       4      92 .]      20     107 ..      17     107 .. 0.97

  Alignments for each domain:
  == domain 1  score: 97.0 bits;  conditional E-value: 3.9e-32
       DUF1318   4 aalaLdeakaqGlvGeqadGylgvvksadaevralvaeiNakRkaaYaeiAakngisleevaklaaqkliekaksGeyvqdadGkWvkK 92 
                   +a +Ldea+a+G vGe+ +Gyl++++++ ae+ alva++N+ R+++Y+++A++ng+s + va+la++kl+++a++G+yvq ++G W +K
  VIMSS7739166  20 RAVTLDEARASGRVGETLSGYLAARSQD-AETLALVARVNRGRAESYQALAQSNGVSRDSVARLAGEKLVARARPGDYVQGINGMWLRK 107
                   6889***********************5.**********************************************************98 PP



Or compare VIMSS7739166 to CDD or PaperBLAST