VIMSS550932 has 149 amino acids
Query: Phage_Mu_Gp36 [M=124] Accession: PF07030.16 Description: Bacteriophage Mu, Gp36 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-41 126.4 0.1 4.3e-41 126.2 0.1 1.0 1 VIMSS550932 Domain annotation for each sequence (and alignments): >> VIMSS550932 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 126.2 0.1 4.3e-41 4.3e-41 1 123 [. 6 133 .. 6 134 .. 0.98 Alignments for each domain: == domain 1 score: 126.2 bits; conditional E-value: 4.3e-41 Phage_Mu_Gp36 1 Yatlddlidrlgedeliqltdree.egaideavveealadAsaeiDsyLakRyalPLatvpevlkrlavdiarYrLysr....eateevkkrYkda 91 Y++l+dl+++++ + li l ++e+ +++i+e+vv++a+++A+++iD++L++Ry lPLa+vp+vl+++a++++rYrLy+r +++e+v ++Yk + VIMSS550932 6 YCSLKDLQEQIPTQSLIWLSNEEPnAQTINEPVVNSAIRYADELIDAHLRGRYILPLAEVPTVLRDAAITLTRYRLYARrpegSIPEAVIDDYKIV 101 9**********************9999****************************************************99888************ PP Phage_Mu_Gp36 92 lklLekvakGklsLgladteetapeseegrva 123 l++L+++++ kl+Lgl +t+++ape++e rv+ VIMSS550932 102 LRQLADIRDAKLTLGLLSTGKDAPEPGEFRVR 133 ****************************9986 PP
Or compare VIMSS550932 to CDD or PaperBLAST