SwissProt::Q9BVX2 has 250 amino acids
Query: TMEM106 [M=141] Accession: PF07092.16 Description: TM106 protein C-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.2e-56 174.2 6.4 9.5e-56 173.9 6.4 1.1 1 SwissProt::Q9BVX2 Domain annotation for each sequence (and alignments): >> SwissProt::Q9BVX2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 173.9 6.4 9.5e-56 9.5e-56 1 141 [] 108 248 .. 108 248 .. 0.99 Alignments for each domain: == domain 1 score: 173.9 bits; conditional E-value: 9.5e-56 TMEM106 1 PrsiavedvGlksskvafdkeeklviLnitnvLnisnsnyysvtvtqltaqvqylktvvGkvklsnvlligPldskqvdytvaseiadelsy 92 P+s++v+d G+k++kv+f+k+++lviL+i ++L+i nsn+y+v+vt+l++q+qy++tvv ++ ++nv+li P++++ v++t ++e++ +sy SwissProt::Q9BVX2 108 PHSVLVDDDGIKVVKVTFNKQDSLVILTIMATLKIRNSNFYTVAVTSLSSQIQYMNTVVSTYVTTNVSLIPPRSEQLVNFTGKAEMGGPFSY 199 9******************************************************************************************* PP TMEM106 93 lykiCtllkikvhnivlfiqvtvtlsylghseqlslesyeyvDCrantt 141 +y +Ct+++i vhniv+f++++v++sy+g ++q+sle+++yvDC++n+t SwissProt::Q9BVX2 200 VYFFCTVPEILVHNIVIFMRTSVKISYIGLMTQSSLETHHYVDCGGNST 248 ***********************************************97 PP
Or compare SwissProt::Q9BVX2 to CDD or PaperBLAST