VIMSS73053 has 76 amino acids
Query: DUF1391 [M=48]
Accession: PF07151.16
Description: Protein of unknown function (DUF1391)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.3e-38 114.4 0.4 1.1e-37 114.0 0.4 1.2 1 VIMSS73053
Domain annotation for each sequence (and alignments):
>> VIMSS73053
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 114.0 0.4 1.1e-37 1.1e-37 3 46 .. 30 73 .. 28 75 .. 0.95
Alignments for each domain:
== domain 1 score: 114.0 bits; conditional E-value: 1.1e-37
DUF1391 3 iDLGnnesLvCGvfPnqDGtftamtytksktfktetGarrWLek 46
+DLGnnesLvCGvfPnqDGtftamtytksktfkte GarrWL +
VIMSS73053 30 LDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTESGARRWLAR 73
7****************************************975 PP
Or compare VIMSS73053 to CDD or PaperBLAST