VIMSS93407 has 51 amino acids
Query: DUF1391 [M=48]
Accession: PF07151.16
Description: Protein of unknown function (DUF1391)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.8e-45 136.9 0.9 8.5e-45 136.8 0.9 1.0 1 VIMSS93407
Domain annotation for each sequence (and alignments):
>> VIMSS93407
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 136.8 0.9 8.5e-45 8.5e-45 1 48 [] 2 49 .. 2 49 .. 0.99
Alignments for each domain:
== domain 1 score: 136.8 bits; conditional E-value: 8.5e-45
DUF1391 1 qkiDLGnnesLvCGvfPnqDGtftamtytksktfktetGarrWLekht 48
qkiDLGnnesLvCGvfPnqDGtftamtytksktfktetGarrWLekht
VIMSS93407 2 QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT 49
9**********************************************9 PP
Or compare VIMSS93407 to CDD or PaperBLAST