Q481E4 has 68 amino acids
Query: DUF1414 [M=44]
Accession: PF07208.15
Description: Protein of unknown function (DUF1414)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.8e-20 58.0 0.1 5.4e-20 57.5 0.1 1.3 1 Q481E4
Domain annotation for each sequence (and alignments):
>> Q481E4
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 57.5 0.1 5.4e-20 5.4e-20 4 44 .] 29 68 .] 26 68 .] 0.94
Alignments for each domain:
== domain 1 score: 57.5 bits; conditional E-value: 5.4e-20
DUF1414 4 pvDLsLMvLGNlvTnilnqsVpeaqReaiAekFaqALksSv 44
+DL+LM+LGN+vTni+ +Vpe++R a++++F++ALk+Sv
Q481E4 29 TPDLALMCLGNAVTNIIA-QVPESKRVAVVDNFTKALKQSV 68
57***************7.6********************8 PP
Or compare Q481E4 to CDD or PaperBLAST