PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS149552 to PF07208 (DUF1414)

VIMSS149552 has 75 amino acids

Query:       DUF1414  [M=44]
Accession:   PF07208.15
Description: Protein of unknown function (DUF1414)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.6e-29   88.0   1.1      2e-29   87.7   1.1    1.2  1  VIMSS149552  


Domain annotation for each sequence (and alignments):
>> VIMSS149552  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   87.7   1.1     2e-29     2e-29       1      44 []      26      69 ..      26      69 .. 0.99

  Alignments for each domain:
  == domain 1  score: 87.7 bits;  conditional E-value: 2e-29
      DUF1414  1 HkApvDLsLMvLGNlvTnilnqsVpeaqReaiAekFaqALksSv 44
                 HkAp+DLsLMvLGN+vTn++n+sV++aqR+aiA++Fa AL+sS+
  VIMSS149552 26 HKAPTDLSLMVLGNMVTNLINTSVAPAQRQAIANSFARALQSSI 69
                 9******************************************8 PP



Or compare VIMSS149552 to CDD or PaperBLAST