VIMSS345799 has 75 amino acids
Query: DUF1414 [M=44] Accession: PF07208.15 Description: Protein of unknown function (DUF1414) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-29 88.0 1.1 2e-29 87.7 1.1 1.2 1 VIMSS345799 Domain annotation for each sequence (and alignments): >> VIMSS345799 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 87.7 1.1 2e-29 2e-29 1 44 [] 26 69 .. 26 69 .. 0.99 Alignments for each domain: == domain 1 score: 87.7 bits; conditional E-value: 2e-29 DUF1414 1 HkApvDLsLMvLGNlvTnilnqsVpeaqReaiAekFaqALksSv 44 HkAp+DLsLMvLGN+vTn++n+sV++aqR+aiA++Fa AL+sS+ VIMSS345799 26 HKAPTDLSLMVLGNMVTNLINTSVAPAQRQAIANSFARALQSSI 69 9******************************************8 PP
Or compare VIMSS345799 to CDD or PaperBLAST