VIMSS619968 has 75 amino acids
Query: DUF1414 [M=44] Accession: PF07208.15 Description: Protein of unknown function (DUF1414) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-28 84.0 0.4 3.7e-28 83.6 0.4 1.2 1 VIMSS619968 Domain annotation for each sequence (and alignments): >> VIMSS619968 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 83.6 0.4 3.7e-28 3.7e-28 1 44 [] 26 69 .. 26 69 .. 0.99 Alignments for each domain: == domain 1 score: 83.6 bits; conditional E-value: 3.7e-28 DUF1414 1 HkApvDLsLMvLGNlvTnilnqsVpeaqReaiAekFaqALksSv 44 H++p+DLsLMvLGN+vTn++n+s+++aqR+++A +Fa+AL++Sv VIMSS619968 26 HRTPTDLSLMVLGNMVTNLINTSIAPAQRKVLARSFAEALQASV 69 9******************************************8 PP
Or compare VIMSS619968 to CDD or PaperBLAST