PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS80960 to PF07208 (DUF1414)

VIMSS80960 has 74 amino acids

Query:       DUF1414  [M=44]
Accession:   PF07208.15
Description: Protein of unknown function (DUF1414)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    4.4e-24   70.6   2.4    4.4e-24   70.6   2.4    1.4  2  VIMSS80960  


Domain annotation for each sequence (and alignments):
>> VIMSS80960  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -3.4   0.0      0.56      0.56      19      25 ..      15      21 ..      12      23 .. 0.73
   2 !   70.6   2.4   4.4e-24   4.4e-24       1      44 []      26      69 ..      26      69 .. 0.99

  Alignments for each domain:
  == domain 1  score: -3.4 bits;  conditional E-value: 0.56
     DUF1414 19 ilnqsVp 25
                iln +++
  VIMSS80960 15 ILNDMIA 21
                7887776 PP

  == domain 2  score: 70.6 bits;  conditional E-value: 4.4e-24
     DUF1414  1 HkApvDLsLMvLGNlvTnilnqsVpeaqReaiAekFaqALksSv 44
                H+ApvDLsL vLGN+vTn+l +sV ++qR a+A++F++AL +Sv
  VIMSS80960 26 HQAPVDLSLVVLGNMVTNLLVSSVGTNQRIALANAFSEALLNSV 69
                9******************************************8 PP



Or compare VIMSS80960 to CDD or PaperBLAST