WP_011079957.1 has 129 amino acids
Query: DUF1425 [M=96]
Accession: PF07233.16
Description: Protein of unknown function (DUF1425)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.7e-32 95.1 0.0 1.2e-31 94.8 0.0 1.1 1 WP_011079957.1
Domain annotation for each sequence (and alignments):
>> WP_011079957.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 94.8 0.0 1.2e-31 1.2e-31 1 95 [. 31 125 .. 31 126 .. 0.98
Alignments for each domain:
== domain 1 score: 94.8 bits; conditional E-value: 1.2e-31
DUF1425 1 qelvidssvlasrvsveelktrrsngllrasvvlenksktdltlqYrFyWyDedGlevepeaepwqsltlhgkesvtlqavapnprAskfrlyvr 95
q++++ ++vl r+ v+++ t++++++ ra v+l+++ k+d+++ YrF WyD++Glev+++ pw++++++g es+tl++v+ np+++++rl++r
WP_011079957.1 31 QHVFFHDNVLGGRLLVDDIATTQVDDRARAVVRLTSNFKGDQNILYRFAWYDDNGLEVNTKPGPWRQAIVRGFESITLSEVTVNPNGTQYRLQIR 125
78999*****************************************************************************************9 PP
Or compare WP_011079957.1 to CDD or PaperBLAST