VIMSS1955901 has 49 amino acids
Query: DUF1440 [M=135]
Accession: PF07274.16
Description: Protein of unknown function (DUF1440)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.2e-14 40.0 0.6 2.5e-14 39.8 0.6 1.0 1 VIMSS1955901
Domain annotation for each sequence (and alignments):
>> VIMSS1955901
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 39.8 0.6 2.5e-14 2.5e-14 102 135 .] 1 34 [. 1 34 [. 0.97
Alignments for each domain:
== domain 1 score: 39.8 bits; conditional E-value: 2.5e-14
DUF1440 102 lPllglvpaakdlpleehvsEilghivwlwtiel 135
+Pl+ vp++ ++p++eh+sEi+ghivwlw +e+
VIMSS1955901 1 MPLIAEVPPLCEIPFDEHLSEIFGHIVWLWGMEI 34
9******************************996 PP
Or compare VIMSS1955901 to CDD or PaperBLAST