NP_001347946.1 has 647 amino acids
Query: D-Glu_cyclase [M=143] Accession: PF07286.16 Description: D-glutamate cyclase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.5e-57 177.2 0.0 1.4e-56 176.6 0.0 1.3 1 NP_001347946.1 Domain annotation for each sequence (and alignments): >> NP_001347946.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 176.6 0.0 1.4e-56 1.4e-56 1 142 [. 145 286 .. 145 287 .. 0.99 Alignments for each domain: == domain 1 score: 176.6 bits; conditional E-value: 1.4e-56 D-Glu_cyclase 1 VtFliGcSfsfeeaLleaglpvrhieegrnvpmYktnielepagvfsgklvvsmrpikkdkvekavqitsrlpkvhGapvhiGdpellgikdlsk 95 VtF+i+cSfs+eeaL++ag+p r+++ ++ ++Ykt++++++ + f+++lvv+mrpi+kdk+e+++q+t++++ ++G+p+hiGdp llgi+ lsk NP_001347946.1 145 VTFIIDCSFSIEEALEQAGIPRRDLTGPSHAGAYKTTVPCATIAGFCCPLVVTMRPIPKDKLERLLQATHAIRGQQGQPIHIGDPGLLGIEALSK 239 8********************************************************************************************** PP D-Glu_cyclase 96 pdyGdaveikegevPvFwacgvTpqeavmsaklelaithapghmlvt 142 pdyG ve+++++vPvFw++ +T++eav s+k++la+++ pg+m+++ NP_001347946.1 240 PDYGSYVECRPEDVPVFWPSPLTSLEAVISCKAPLAFASPPGCMVMV 286 ********************************************985 PP
Or compare NP_001347946.1 to CDD or PaperBLAST