Q7Z3D6 has 616 amino acids
Query: D-Glu_cyclase [M=143] Accession: PF07286.16 Description: D-glutamate cyclase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-49 153.7 0.0 2.5e-49 153.0 0.0 1.4 1 Q7Z3D6 Domain annotation for each sequence (and alignments): >> Q7Z3D6 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 153.0 0.0 2.5e-49 2.5e-49 1 143 [] 118 255 .. 118 255 .. 0.98 Alignments for each domain: == domain 1 score: 153.0 bits; conditional E-value: 2.5e-49 D-Glu_cyclase 1 VtFliGcSfsfeeaLleaglpvrhieegrnvpmYktnielepagvfsgklvvsmrpikkdkvekavqitsrlpkvhGapvhiGdpellgikdlskp 96 V+F++GcSfs+eeaL++aglp r+ + +++ t++++ +++ f+++lvv+mrpi+kdk+e +v+++++l ++G+pvh+Gdpellgik+lskp Q7Z3D6 118 VAFFLGCSFSLEEALEKAGLPRRDPAGHSQ-----TTVPCVTHAGFCCPLVVTMRPIPKDKLEGLVRACCSLGGEQGQPVHMGDPELLGIKELSKP 208 89**********************988875.....9************************************************************ PP D-Glu_cyclase 97 dyGdaveikegevPvFwacgvTpqeavmsaklelaithapghmlvtd 143 yGda+ + +gevPvFw++ +T++ av+s++++la+++ pg++++td Q7Z3D6 209 AYGDAMVCPPGEVPVFWPSPLTSLGAVSSCETPLAFASIPGCTVMTD 255 *********************************************98 PP
Or compare Q7Z3D6 to CDD or PaperBLAST