VIMSS836059 has 261 amino acids
Query: D-Glu_cyclase [M=143] Accession: PF07286.16 Description: D-glutamate cyclase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.6e-67 210.2 0.0 7.3e-67 209.9 0.0 1.1 1 VIMSS836059 Domain annotation for each sequence (and alignments): >> VIMSS836059 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 209.9 0.0 7.3e-67 7.3e-67 2 143 .] 110 252 .. 109 252 .. 0.99 Alignments for each domain: == domain 1 score: 209.9 bits; conditional E-value: 7.3e-67 D-Glu_cyclase 2 tFliGcSfsfeeaLleaglpvrhieegrnvpmYktnielepagvfsgklvvsmrpikkdkvekavqitsrlpkvhGapvhiGdpellgikdlskpd 97 tF++GcS+sfe L+eag+p++hie+++ vpmY+t+i++epag+fsgklvvsmrp++++++ + +qi+sr+p+vhGap+h+Gdp+++gikd+ +p+ VIMSS836059 110 TFVLGCSMSFELPLIEAGIPIQHIENDTIVPMYRTSIDCEPAGQFSGKLVVSMRPLNSKDAIRSIQISSRFPAVHGAPIHLGDPSEIGIKDIMNPE 205 8*********************************************************************************************** PP D-Glu_cyclase 98 yGdave.ikegevPvFwacgvTpqeavmsaklelaithapghmlvtd 143 yGd+++ +k++e+PvFwacgvTpq++++++k++++ithapg+ml+td VIMSS836059 206 YGDPPKaFKNNEIPVFWACGVTPQSVLQDSKPDFCITHAPGKMLITD 252 ***987699*************************************9 PP
Or compare VIMSS836059 to CDD or PaperBLAST