NP_415176.1 has 160 amino acids
Query: DUF1451 [M=147] Accession: PF07295.15 Description: Zinc-ribbon containing domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-53 167.3 0.3 1.4e-53 167.2 0.3 1.0 1 NP_415176.1 Domain annotation for each sequence (and alignments): >> NP_415176.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 167.2 0.3 1.4e-53 1.4e-53 2 147 .] 14 157 .. 13 157 .. 0.98 Alignments for each domain: == domain 1 score: 167.2 bits; conditional E-value: 1.4e-53 DUF1451 2 eleeaeeksaesLeealekakeklveageltkeelelvaeylkrDleeaarsleeskedlrewlsldlelleesllealasiaDrtqvelaelaedle 99 +l+e+ +++++++++++e+a+e++ ++gelt+ e+++++++++rDlee+a s+ees + +e++s+++++++esl+++la+i+D+tq+e++e+++dl+ NP_415176.1 14 SLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEESLK--EESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLN 109 57899999************************************************99..79************************************ PP DUF1451 100 hagvyqaGevvgpGtlvCdkCgkelalkkpgkippCpkCgateFrRep 147 h+gvy++Gevvg+G+lvC+kC+ +l +++p++++ CpkCg+++F+R+p NP_415176.1 110 HHGVYHSGEVVGLGNLVCEKCHFHLPIYTPEVLTLCPKCGHDQFQRRP 157 **********************************************86 PP
Or compare NP_415176.1 to CDD or PaperBLAST