VIMSS14780 has 160 amino acids
Query: DUF1451 [M=147] Accession: PF07295.15 Description: Zinc-ribbon containing domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-53 167.3 0.3 1.4e-53 167.2 0.3 1.0 1 VIMSS14780 Domain annotation for each sequence (and alignments): >> VIMSS14780 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 167.2 0.3 1.4e-53 1.4e-53 2 147 .] 14 157 .. 13 157 .. 0.98 Alignments for each domain: == domain 1 score: 167.2 bits; conditional E-value: 1.4e-53 DUF1451 2 eleeaeeksaesLeealekakeklveageltkeelelvaeylkrDleeaarsleeskedlrewlsldlelleesllealasiaDrtqvelaelaedleh 100 +l+e+ +++++++++++e+a+e++ ++gelt+ e+++++++++rDlee+a s+ees + +e++s+++++++esl+++la+i+D+tq+e++e+++dl+h VIMSS14780 14 SLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLEEFAMSYEESLK--EESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNH 110 57899999************************************************99..79************************************* PP DUF1451 101 agvyqaGevvgpGtlvCdkCgkelalkkpgkippCpkCgateFrRep 147 +gvy++Gevvg+G+lvC+kC+ +l +++p++++ CpkCg+++F+R+p VIMSS14780 111 HGVYHSGEVVGLGNLVCEKCHFHLPIYTPEVLTLCPKCGHDQFQRRP 157 *********************************************86 PP
Or compare VIMSS14780 to CDD or PaperBLAST