VIMSS200355 has 148 amino acids
Query: DUF1451 [M=147] Accession: PF07295.15 Description: Zinc-ribbon containing domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-54 168.7 0.2 5.3e-54 168.5 0.2 1.0 1 VIMSS200355 Domain annotation for each sequence (and alignments): >> VIMSS200355 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 168.5 0.2 5.3e-54 5.3e-54 2 146 .. 4 144 .. 3 145 .. 0.98 Alignments for each domain: == domain 1 score: 168.5 bits; conditional E-value: 5.3e-54 DUF1451 2 eleeaeeksaesLeealekakeklveageltkeelelvaeylkrDleeaarsleeskedlrewlsldlelleesllealasiaDrtqvelaelaedle 99 +++e+++ +a++L + +++ ke+l+ ++++ ++el+lv+++lkrD+ ++ r++++ + ++s++l +le++l+++l++i+Dr+qve++el++d++ VIMSS200355 4 QFAEDNSLTAKNLFKSVTQGKEFLRLKEQAGEDELALVEQFLKRDIVSFLREQNADSL----SHSPTLITLENTLWHWLSEITDRSQVEWHELTQDFK 97 578999****************************************************....8*********************************** PP DUF1451 100 hagvyqaGevvgpGtlvCdkCgkelalkkpgkippCpkCgateFrRe 146 h+g+yq+G++v++G +vC++Cg+e++++ pg+ip+Cp+C+++eF+Re VIMSS200355 98 HHGYYQSGDIVSQGIMVCTNCGHEMSIEFPGVIPDCPECDHEEFTRE 144 **********************************************8 PP
Or compare VIMSS200355 to CDD or PaperBLAST