VIMSS271733 has 166 amino acids
Query: DUF1451 [M=147] Accession: PF07295.15 Description: Zinc-ribbon containing domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-55 173.3 0.5 2e-55 173.1 0.5 1.1 1 VIMSS271733 Domain annotation for each sequence (and alignments): >> VIMSS271733 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 173.1 0.5 2e-55 2e-55 2 147 .] 20 163 .. 19 163 .. 0.97 Alignments for each domain: == domain 1 score: 173.1 bits; conditional E-value: 2e-55 DUF1451 2 eleeaeeksaesLeealekakeklveageltkeelelvaeylkrDleeaarsleeskedlrewlsldlelleesllealasiaDrtqvelaelaedle 99 +l+e+ +++++++++++e+a+++l+ +elt++++e++ ++++rDlee+ars+eeske+ +s+++++++esl+++la+i+D+tq+e++e+++d++ VIMSS271733 20 SLTERLKNGERDIDQLVESAERRLHTVEELTRNDVEQIVQAVRRDLEEFARSYEESKEE--FRDSVFMRVIKESLWQELADITDKTQLEWREVFKDVS 115 5789999***************************************************5..5779********************************* PP DUF1451 100 hagvyqaGevvgpGtlvCdkCgkelalkkpgkippCpkCgateFrRep 147 h+gvy++Gevvg+G+lvC+kC+++la+++p+++p CpkCg+++F+R+p VIMSS271733 116 HHGVYHSGEVVGLGNLVCEKCHYHLAFYTPEVLPVCPKCGHDQFTRRP 163 **********************************************86 PP
Or compare VIMSS271733 to CDD or PaperBLAST