VIMSS53560 has 156 amino acids
Query: DUF1451 [M=147] Accession: PF07295.15 Description: Zinc-ribbon containing domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.4e-53 164.8 0.0 8.4e-53 164.6 0.0 1.0 1 VIMSS53560 Domain annotation for each sequence (and alignments): >> VIMSS53560 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 164.6 0.0 8.4e-53 8.4e-53 2 147 .] 14 153 .. 13 153 .. 0.98 Alignments for each domain: == domain 1 score: 164.6 bits; conditional E-value: 8.4e-53 DUF1451 2 eleeaeeksaesLeealekakeklveageltkeelelvaeylkrDleeaarsleeskedlrewlsldlelleesllealasiaDrtqvelaelaedleh 100 e+ e+ ++s + ++e++e++ +++++a++ltk+el+l+++y+k Dl+e+++s e+sk+ s+++ ++ +s+++ l++i+Drt+ve+ el++dleh VIMSS53560 14 EVVETLKHSPDGVNEIVESSAKYVDAANDLTKDELALISAYVKADLKEFSQSFEQSKS------SPFYLMITNSIWQGLLDITDRTKVEWVELFADLEH 106 5778999*************************************************99......9********************************** PP DUF1451 101 agvyqaGevvgpGtlvCdkCgkelalkkpgkippCpkCgateFrRep 147 +g+yqaG+++g+G+l+Cd+Cg+++++++p++i+pC++Cg++ F+R+p VIMSS53560 107 QGLYQAGDMIGLGVLICDQCGHKTEFNHPTEIEPCSQCGGKAFSRQP 153 *********************************************96 PP
Or compare VIMSS53560 to CDD or PaperBLAST