WP_005373024.1 has 156 amino acids
Query: DUF1451 [M=147] Accession: PF07295.15 Description: Zinc-ribbon containing domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-51 159.6 0.0 3.3e-51 159.4 0.0 1.0 1 WP_005373024.1 Domain annotation for each sequence (and alignments): >> WP_005373024.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 159.4 0.0 3.3e-51 3.3e-51 3 146 .. 15 152 .. 13 153 .. 0.98 Alignments for each domain: == domain 1 score: 159.4 bits; conditional E-value: 3.3e-51 DUF1451 3 leeaeeksaesLeealekakeklveageltkeelelvaeylkrDleeaarsleeskedlrewlsldlelleesllealasiaDrtqvelaelaed 97 + e+ ++s e++++a+e++ + +++a++ltk+el+l+++ylk Dl+e+++s+e+sk+ +++ ++ +s+++ l++i+Drt+ve+ el++d WP_005373024.1 15 VIETLKHSPEEVNKAIETSGKVVDAANDLTKDELALIKAYLKADLKEFSESYEDSKS------GPFYLTIADSIWQGLLEITDRTKVEWVELFDD 103 678999***************************************************......8******************************* PP DUF1451 98 lehagvyqaGevvgpGtlvCdkCgkelalkkpgkippCpkCgateFrRe 146 leh+g+y+aGev+g+GtlvCd+Cg+++++++p++i pC kCg++ F+R+ WP_005373024.1 104 LEHQGLYEAGEVIGLGTLVCDECGHKTTYNHPTVIIPCIKCGHKGFTRQ 152 ************************************************8 PP
Or compare WP_005373024.1 to CDD or PaperBLAST