WP_011788416.1 has 166 amino acids
Query: DUF1451 [M=147] Accession: PF07295.15 Description: Zinc-ribbon containing domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-54 168.9 0.3 4.8e-54 168.6 0.3 1.0 1 WP_011788416.1 Domain annotation for each sequence (and alignments): >> WP_011788416.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 168.6 0.3 4.8e-54 4.8e-54 2 147 .] 22 163 .. 21 163 .. 0.98 Alignments for each domain: == domain 1 score: 168.6 bits; conditional E-value: 4.8e-54 DUF1451 2 eleeaeeksaesLeealekakeklveageltkeelelvaeylkrDleeaarsleeskedlrewlsldlelleesllealasiaDrtqvelaelae 96 +++e+++ +a++L + +++ ke+l+ +++++++el+lv+++lkrD++++ r++++ + ++s++l +le++l+++l++i+Dr+qve++el++ WP_011788416.1 22 QFAEDNTLTAKNLFKSVTQGKEFLRLKEQAKEDELALVEQFLKRDIASFLREQNADSL----SHSPSLIVLENTLWHWLSEITDRSQVEWHELTQ 112 6789999***************************************************....8******************************** PP DUF1451 97 dlehagvyqaGevvgpGtlvCdkCgkelalkkpgkippCpkCgateFrRep 147 d++h+g+yq+G++v++G +vC++Cg+e++++ p++ip+Cp+C+++eF+Rep WP_011788416.1 113 DFKHHGYYQSGDIVNQGIMVCTNCGHEMSIEFPSEIPDCPECDNEEFTREP 163 *************************************************86 PP
Or compare WP_011788416.1 to CDD or PaperBLAST