Q1RFK1 has 91 amino acids
Query: YdgH_BhsA-like [M=55] Accession: PF07338.17 Description: YdgH/BhsA/McbA-like domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-17 50.0 0.8 1.5e-17 49.7 0.2 1.4 2 Q1RFK1 Domain annotation for each sequence (and alignments): >> Q1RFK1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.1 0.0 0.47 0.47 31 40 .. 10 19 .. 10 24 .. 0.70 2 ! 49.7 0.2 1.5e-17 1.5e-17 1 55 [] 37 89 .. 37 89 .. 0.98 Alignments for each domain: == domain 1 score: -3.1 bits; conditional E-value: 0.47 YdgH_BhsA-like 31 GAksYrIisa 40 GA ++ ++ + Q1RFK1 10 GALAFAVTNV 19 6777777765 PP == domain 2 score: 49.7 bits; conditional E-value: 1.5e-17 YdgH_BhsA-like 1 lqpiGtisvtgvfsslsdleaalakkAdakGAksYrIisasenggnlrgtAdlYk 55 +++iG is++ + s d++++l kkAd+kGA+ + +s ++ +++++gtA +Yk Q1RFK1 37 YEKIGDISTS-NEMSTADAKEDLIKKADEKGADVLVLTSGQT-DNKIHGTANIYK 89 689*******.*******************************.***********9 PP
Or compare Q1RFK1 to CDD or PaperBLAST