VIMSS14931 has 86 amino acids
Query: YdgH_BhsA-like [M=55]
Accession: PF07338.17
Description: YdgH/BhsA/McbA-like domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.3e-24 69.6 0.1 1.4e-23 69.0 0.1 1.3 1 VIMSS14931
Domain annotation for each sequence (and alignments):
>> VIMSS14931
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 69.0 0.1 1.4e-23 1.4e-23 1 55 [] 34 86 .] 34 86 .] 0.98
Alignments for each domain:
== domain 1 score: 69.0 bits; conditional E-value: 1.4e-23
YdgH_BhsA-like 1 lqpiGtisvtgvfsslsdleaalakkAdakGAksYrIisasenggnlrgtAdlYk 55
l p+Gt+s+t ++s+lsdle++la+kA ++GAk Y+I sa + ++++ gtA++Yk
VIMSS14931 34 LRPAGTVSAT-GASNLSDLEDKLAEKAREQGAKGYVINSAGG-NDQMFGTATIYK 86
689*******.*******************************.***********9 PP
Or compare VIMSS14931 to CDD or PaperBLAST