VIMSS150652 has 87 amino acids
Query: YdgH_BhsA-like [M=55] Accession: PF07338.17 Description: YdgH/BhsA/McbA-like domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-27 80.3 0.3 6.1e-27 79.8 0.3 1.3 1 VIMSS150652 Domain annotation for each sequence (and alignments): >> VIMSS150652 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 79.8 0.3 6.1e-27 6.1e-27 2 55 .] 35 87 .] 34 87 .] 0.98 Alignments for each domain: == domain 1 score: 79.8 bits; conditional E-value: 6.1e-27 YdgH_BhsA-like 2 qpiGtisvtgvfsslsdleaalakkAdakGAksYrIisasenggnlrgtAdlYk 55 + iG++sv+ + ss++d++a l+kkAd++GA++Y+I++a++ g+n+++tA+lYk VIMSS150652 35 EAIGSVSVSAIGSSPMDMNAMLSKKADEQGATAYHITEARS-GSNWHATAELYK 87 679**************************************.***********9 PP
Or compare VIMSS150652 to CDD or PaperBLAST