VIMSS150653 has 88 amino acids
Query: YdgH_BhsA-like [M=55]
Accession: PF07338.17
Description: YdgH/BhsA/McbA-like domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.3e-27 81.9 0.0 2e-27 81.3 0.0 1.3 1 VIMSS150653
Domain annotation for each sequence (and alignments):
>> VIMSS150653
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 81.3 0.0 2e-27 2e-27 1 55 [] 35 88 .] 35 88 .] 0.99
Alignments for each domain:
== domain 1 score: 81.3 bits; conditional E-value: 2e-27
YdgH_BhsA-like 1 lqpiGtisvtgvfsslsdleaalakkAdakGAksYrIisasenggnlrgtAdlYk 55
lqp+Gtisv+++ s+++d+++++ +kA+++GA sYrIi+ e g+n+++tA+lYk
VIMSS150653 35 LQPMGTISVSQIGSTPMDMRQEIVAKAEKAGANSYRIIELKE-GDNWHATAELYK 88
8*****************************************.***********9 PP
Or compare VIMSS150653 to CDD or PaperBLAST