VIMSS17309 has 87 amino acids
Query: YdgH_BhsA-like [M=55]
Accession: PF07338.17
Description: YdgH/BhsA/McbA-like domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.3e-27 81.1 0.1 3.9e-27 80.4 0.1 1.4 1 VIMSS17309
Domain annotation for each sequence (and alignments):
>> VIMSS17309
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 80.4 0.1 3.9e-27 3.9e-27 2 55 .] 35 87 .] 34 87 .] 0.98
Alignments for each domain:
== domain 1 score: 80.4 bits; conditional E-value: 3.9e-27
YdgH_BhsA-like 2 qpiGtisvtgvfsslsdleaalakkAdakGAksYrIisasenggnlrgtAdlYk 55
+ iGt+sv+gv+ss++d+++ l+kkA++kGA++Y+I++a++ g+++++tA+lYk
VIMSS17309 35 EAIGTVSVSGVASSPMDMREMLNKKAEEKGATAYQITEARS-GDTWHATAELYK 87
679**************************************.***********9 PP
Or compare VIMSS17309 to CDD or PaperBLAST