VIMSS274424 has 92 amino acids
Query: YdgH_BhsA-like [M=55]
Accession: PF07338.17
Description: YdgH/BhsA/McbA-like domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.7e-24 71.3 0.2 4.4e-24 70.6 0.2 1.3 1 VIMSS274424
Domain annotation for each sequence (and alignments):
>> VIMSS274424
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 70.6 0.2 4.4e-24 4.4e-24 1 55 [] 39 92 .] 39 92 .] 0.98
Alignments for each domain:
== domain 1 score: 70.6 bits; conditional E-value: 4.4e-24
YdgH_BhsA-like 1 lqpiGtisvtgvfsslsdleaalakkAdakGAksYrIisasenggnlrgtAdlYk 55
+++iGt+s+tg ++s++d+++al+k Ad+kG+k+Y+Ii+ +e +g++ + A++Yk
VIMSS274424 39 YEKIGTVSTTGEATSPMDVKKALSKLADEKGGKYYVIIAERE-KGKFDADAEVYK 92
68****************************************.***********9 PP
Or compare VIMSS274424 to CDD or PaperBLAST