PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS3626992 to PF07338 (YdgH_BhsA-like)

VIMSS3626992 has 89 amino acids

Query:       YdgH_BhsA-like  [M=55]
Accession:   PF07338.17
Description: YdgH/BhsA/McbA-like domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.2e-21   62.9   0.5    2.8e-21   61.6   0.3    1.6  2  VIMSS3626992  


Domain annotation for each sequence (and alignments):
>> VIMSS3626992  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -1.5   0.0      0.14      0.14       4      16 ..      13      24 ..      13      32 .. 0.64
   2 !   61.6   0.3   2.8e-21   2.8e-21       1      55 []      36      89 .]      36      89 .] 0.95

  Alignments for each domain:
  == domain 1  score: -1.5 bits;  conditional E-value: 0.14
  YdgH_BhsA-like  4 iGtisvtgvfssl 16
                    iG+ s++ vf+++
    VIMSS3626992 13 IGSLSFS-VFAAQ 24
                    5777777.66655 PP

  == domain 2  score: 61.6 bits;  conditional E-value: 2.8e-21
  YdgH_BhsA-like  1 lqpiGtisvtgvfsslsdleaalakkAdakGAksYrIisasenggnlrgtAdlYk 55
                    l++iG i+++   ++++d++++l+kkAd+ G+++Y+I+sa++n+ ++++tAd+Yk
    VIMSS3626992 36 LTKIGDITTS-DTTAPMDAKKELSKKADELGGTYYVITSANKNEKSVHATADVYK 89
                    78********.*******************************5666********9 PP



Or compare VIMSS3626992 to CDD or PaperBLAST