VIMSS95580 has 104 amino acids
Query: YdgH_BhsA-like [M=55]
Accession: PF07338.17
Description: YdgH/BhsA/McbA-like domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.7e-27 80.5 0.1 6.4e-27 79.7 0.1 1.4 1 VIMSS95580
Domain annotation for each sequence (and alignments):
>> VIMSS95580
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 79.7 0.1 6.4e-27 6.4e-27 2 55 .] 52 104 .] 51 104 .] 0.98
Alignments for each domain:
== domain 1 score: 79.7 bits; conditional E-value: 6.4e-27
YdgH_BhsA-like 2 qpiGtisvtgvfsslsdleaalakkAdakGAksYrIisasenggnlrgtAdlYk 55
+ iGt+sv+gv+ss++d+++ l+kkA++kGA++Y+I++a++ g+++++tA+lYk
VIMSS95580 52 EAIGTVSVSGVASSPMDMREMLNKKAEEKGATAYQITEARS-GDTWHATAELYK 104
679**************************************.***********9 PP
Or compare VIMSS95580 to CDD or PaperBLAST