PaperBLAST – Find papers about a protein or its homologs

 

Align WP_024131167.1 to PF07351 (DUF1480)

WP_024131167.1 has 78 amino acids

Query:       DUF1480  [M=78]
Accession:   PF07351.17
Description: Protein of unknown function (DUF1480)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    3.2e-47  144.8   0.0    3.4e-47  144.7   0.0    1.0  1  WP_024131167.1  


Domain annotation for each sequence (and alignments):
>> WP_024131167.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  144.7   0.0   3.4e-47   3.4e-47       3      78 .]       2      77 ..       1      77 [. 0.99

  Alignments for each domain:
  == domain 1  score: 144.7 bits;  conditional E-value: 3.4e-47
         DUF1480  3 ktklrisafeiddavlsseqkgertlsiPcksdpdlcmqldawdeetsiPailngkdsllyrkhydrqkdawvmrv 78
                    kt +ri+afeidda+l++e  gertl+iPcksdpdlcmqldawd+ets+Pailng++s+l+r+hyd ++dawvmr+
  WP_024131167.1  2 KTSVRIGAFEIDDAELHGESPGERTLTIPCKSDPDLCMQLDAWDAETSVPAILNGEHSVLFRNHYDPKSDAWVMRL 77
                    89************************************************************************97 PP



Or compare WP_024131167.1 to CDD or PaperBLAST