VIMSS17343 has 85 amino acids
Query: DUF1488 [M=82]
Accession: PF07369.15
Description: Protein of unknown function (DUF1488)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.2e-36 109.6 0.1 3.5e-36 109.5 0.1 1.0 1 VIMSS17343
Domain annotation for each sequence (and alignments):
>> VIMSS17343
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 109.5 0.1 3.5e-36 3.5e-36 1 82 [] 5 84 .. 5 84 .. 0.99
Alignments for each domain:
== domain 1 score: 109.5 bits; conditional E-value: 3.5e-36
DUF1488 1 IlFpdresydaerqaVrFpaqvdgreveCavsaeaLedhfgaesldeedllaaFdahRfdieeaaerlieaegfdedgtilL 82
I+Fpdre++d+++++V+Fpa+v+g++++Ca+s e L+ +f++++ +e++la F++hR+d+ee+ae+li+++ +d++g+++L
VIMSS17343 5 IQFPDREEWDENKKCVCFPALVNGMQLTCAISGESLAYRFTGDT--PEQWLASFRQHRWDLEEEAENLIQEQSEDDQGWVWL 84
9******************************************8..9*********************************98 PP
Or compare VIMSS17343 to CDD or PaperBLAST