VIMSS2032059 has 86 amino acids
Query: DUF1488 [M=82]
Accession: PF07369.15
Description: Protein of unknown function (DUF1488)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.8e-30 90.6 0.6 3.1e-30 90.4 0.6 1.0 1 VIMSS2032059
Domain annotation for each sequence (and alignments):
>> VIMSS2032059
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 90.4 0.6 3.1e-30 3.1e-30 1 82 [] 5 86 .] 5 86 .] 0.97
Alignments for each domain:
== domain 1 score: 90.4 bits; conditional E-value: 3.1e-30
DUF1488 1 IlFpdresydaerqaVrFpaqvdgreveCavsaeaLedhfgaesldeedllaaFdahRfdieeaaerlieaegfdedgtilL 82
IlFp+ +++a++q++ Fpaq++g++v C++s++ Le++ g ++eed+l+aF+++Rfdie++ae+lie+++f edg i L
VIMSS2032059 5 ILFPELADWQAHEQRIHFPAQQMGALVDCYISRRRLEKMTGLSLAREEDILRAFESVRFDIEDIAEKLIEEQEFAEDGAIYL 86
89**********************************9999999999*********************************986 PP
Or compare VIMSS2032059 to CDD or PaperBLAST