VIMSS2032059 has 86 amino acids
Query: DUF1488 [M=82] Accession: PF07369.15 Description: Protein of unknown function (DUF1488) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-30 90.6 0.6 3.1e-30 90.4 0.6 1.0 1 VIMSS2032059 Domain annotation for each sequence (and alignments): >> VIMSS2032059 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 90.4 0.6 3.1e-30 3.1e-30 1 82 [] 5 86 .] 5 86 .] 0.97 Alignments for each domain: == domain 1 score: 90.4 bits; conditional E-value: 3.1e-30 DUF1488 1 IlFpdresydaerqaVrFpaqvdgreveCavsaeaLedhfgaesldeedllaaFdahRfdieeaaerlieaegfdedgtilL 82 IlFp+ +++a++q++ Fpaq++g++v C++s++ Le++ g ++eed+l+aF+++Rfdie++ae+lie+++f edg i L VIMSS2032059 5 ILFPELADWQAHEQRIHFPAQQMGALVDCYISRRRLEKMTGLSLAREEDILRAFESVRFDIEDIAEKLIEEQEFAEDGAIYL 86 89**********************************9999999999*********************************986 PP
Or compare VIMSS2032059 to CDD or PaperBLAST