VIMSS95615 has 85 amino acids
Query: DUF1488 [M=82]
Accession: PF07369.15
Description: Protein of unknown function (DUF1488)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.6e-35 105.4 0.1 7.2e-35 105.3 0.1 1.0 1 VIMSS95615
Domain annotation for each sequence (and alignments):
>> VIMSS95615
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 105.3 0.1 7.2e-35 7.2e-35 1 82 [] 5 84 .. 5 84 .. 0.99
Alignments for each domain:
== domain 1 score: 105.3 bits; conditional E-value: 7.2e-35
DUF1488 1 IlFpdresydaerqaVrFpaqvdgreveCavsaeaLedhfgaesldeedllaaFdahRfdieeaaerlieaegfdedgtilL 82
I+Fpdre++ +++++V+Fpa+v+g++++Ca+s + L+ +f++++ +e++la F++hR+d+ee+ae+li+++ +d++g+++L
VIMSS95615 5 IQFPDREEWVENKKCVCFPALVNGMQLTCAISGDSLAYRFTGDT--PEQWLASFRQHRWDLEEEAENLIQEQSEDDQGWVWL 84
9******************************************8..9*********************************98 PP
Or compare VIMSS95615 to CDD or PaperBLAST