VIMSS342010 has 90 amino acids
Query: DUF1496 [M=53]
Accession: PF07383.16
Description: Protein of unknown function (DUF1496)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5e-30 89.2 0.5 6.5e-30 88.8 0.5 1.2 1 VIMSS342010
Domain annotation for each sequence (and alignments):
>> VIMSS342010
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 88.8 0.5 6.5e-30 6.5e-30 1 53 [] 35 87 .. 35 87 .. 0.97
Alignments for each domain:
== domain 1 score: 88.8 bits; conditional E-value: 6.5e-30
DUF1496 1 lVitagklvqrvCyYedkaYseGAvikvegvlLqCareneqesngnLiWlelk 53
lV+++gk+ qr+CyYedkaY++GAvikv++vlL+C++en++e+ng+L+W+ lk
VIMSS342010 35 LVVADGKIGQRICYYEDKAYTAGAVIKVDDVLLVCSDENDYETNGSLKWVVLK 87
69***********************************************9986 PP
Or compare VIMSS342010 to CDD or PaperBLAST