VIMSS54336 has 93 amino acids
Query: DUF1496 [M=53]
Accession: PF07383.16
Description: Protein of unknown function (DUF1496)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.2e-26 76.3 0.1 6.9e-26 75.9 0.1 1.2 1 VIMSS54336
Domain annotation for each sequence (and alignments):
>> VIMSS54336
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 75.9 0.1 6.9e-26 6.9e-26 8 52 .. 34 78 .. 28 79 .. 0.92
Alignments for each domain:
== domain 1 score: 75.9 bits; conditional E-value: 6.9e-26
DUF1496 8 lvqrvCyYedkaYseGAvikvegvlLqCareneqesngnLiWlel 52
+ +rvCyY+d+aYseGAvi v++v+L C+r n++e+ng+L+Wl l
VIMSS54336 34 IAKRVCYYQDQAYSEGAVILVGEVYLSCQRANDFETNGPLKWLPL 78
668***************************************865 PP
Or compare VIMSS54336 to CDD or PaperBLAST