VIMSS2056927 has 110 amino acids
Query: DUF1508 [M=48] Accession: PF07411.16 Description: Domain of unknown function (DUF1508) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-49 150.2 2.1 1.2e-25 75.5 0.1 2.0 2 VIMSS2056927 Domain annotation for each sequence (and alignments): >> VIMSS2056927 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 75.5 0.1 1.2e-25 1.2e-25 2 48 .] 11 57 .. 10 57 .. 0.97 2 ! 74.9 0.4 1.8e-25 1.8e-25 1 48 [] 61 108 .. 61 108 .. 0.98 Alignments for each domain: == domain 1 score: 75.5 bits; conditional E-value: 1.2e-25 DUF1508 2 knGkfrFrLkaaNgevIatsegYsskaaaengIesVkknapdaeveD 48 ++ +frF+Lka+Nge+I+tse Y+ska+ae+gI+sV++n+p+ e+++ VIMSS2056927 11 SDSQFRFVLKAGNGETILTSELYTSKASAEKGIASVRSNSPQEERYE 57 899*****************************************997 PP == domain 2 score: 74.9 bits; conditional E-value: 1.8e-25 DUF1508 1 DknGkfrFrLkaaNgevIatsegYsskaaaengIesVkknapdaeveD 48 ++nGkf+F+LkaaN+++I++s++Y++ +++e gI+sVk n+++++v+D VIMSS2056927 61 ASNGKFYFNLKAANHQIIGSSQMYATAQSRETGIASVKANGTSQTVKD 108 69********************************************98 PP
Or compare VIMSS2056927 to CDD or PaperBLAST