VIMSS331256 has 143 amino acids
Query: DUF1508 [M=48]
Accession: PF07411.16
Description: Domain of unknown function (DUF1508)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.4e-17 47.3 0.2 1.1e-16 46.7 0.2 1.2 1 VIMSS331256
Domain annotation for each sequence (and alignments):
>> VIMSS331256
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 46.7 0.2 1.1e-16 1.1e-16 1 39 [. 93 131 .. 93 138 .. 0.95
Alignments for each domain:
== domain 1 score: 46.7 bits; conditional E-value: 1.1e-16
DUF1508 1 DknGkfrFrLkaaNgevIatsegYsskaaaengIesVkk 39
++nG+++F+ + +N+e++atse+Y +k +ae+ Ies+k+
VIMSS331256 93 ASNGQYYFVIRSSNNEIVATSETYLTKYSAEKTIESIKN 131
69***********************************97 PP
Or compare VIMSS331256 to CDD or PaperBLAST