WP_017968150.1 has 62 amino acids
Query: DUF1508 [M=48]
Accession: PF07411.16
Description: Domain of unknown function (DUF1508)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3e-26 77.4 0.3 3.6e-26 77.1 0.3 1.1 1 WP_017968150.1
Domain annotation for each sequence (and alignments):
>> WP_017968150.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 77.1 0.3 3.6e-26 3.6e-26 1 48 [] 9 56 .. 9 56 .. 0.99
Alignments for each domain:
== domain 1 score: 77.1 bits; conditional E-value: 3.6e-26
DUF1508 1 DknGkfrFrLkaaNgevIatsegYsskaaaengIesVkknapdaeveD 48
Dk+G+frFr+ka+Nge +++segY++ka+a+ +Ies+kkn p+aev+D
WP_017968150.1 9 DKAGEFRFRFKASNGEAMFSSEGYKAKASAMSAIESIKKNTPSAEVVD 56
8*********************************************98 PP
Or compare WP_017968150.1 to CDD or PaperBLAST