VIMSS39917 has 207 amino acids
Query: DUF1648 [M=49]
Accession: PF07853.15
Description: Domain of unknown function (DUF1648)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.3e-15 40.9 1.3 6.3e-15 40.9 1.3 3.3 3 VIMSS39917
Domain annotation for each sequence (and alignments):
>> VIMSS39917
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 40.9 1.3 6.3e-15 6.3e-15 1 49 [] 9 56 .. 9 56 .. 0.95
2 ? -1.0 0.0 0.078 0.078 32 44 .. 152 164 .. 152 171 .. 0.57
3 ? -1.4 2.1 0.11 0.11 12 13 .. 187 188 .. 177 204 .. 0.52
Alignments for each domain:
== domain 1 score: 40.9 bits; conditional E-value: 6.3e-15
DUF1648 1 llillplvlglilypkLPdqiPtHfnasGepDgygsKlfglfllPllll 49
+++ l+++ ++ily+ LP++iP+++ +p + +sK+ ++f++P+++l
VIMSS39917 9 IIVCLSFLTSIILYQYLPEEIPIQWSG-NKPAAIVSKPLTIFIIPVVML 56
6999*********************74.5******************96 PP
== domain 2 score: -1.0 bits; conditional E-value: 0.078
DUF1648 32 DgygsKlfglfll 44
++++sK ++ ++
VIMSS39917 152 NRFASKVLVVCGF 164
5777774444444 PP
== domain 3 score: -1.4 bits; conditional E-value: 0.11
DUF1648 12 il 13
++
VIMSS39917 187 LA 188
22 PP
Or compare VIMSS39917 to CDD or PaperBLAST