WP_003726112.1 has 204 amino acids
Query: DUF1648 [M=49]
Accession: PF07853.15
Description: Domain of unknown function (DUF1648)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-17 49.6 3.5 1.2e-17 49.6 3.5 2.3 3 WP_003726112.1
Domain annotation for each sequence (and alignments):
>> WP_003726112.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 49.6 3.5 1.2e-17 1.2e-17 1 49 [] 10 58 .. 10 58 .. 0.97
2 ? -3.6 0.5 0.5 0.5 4 8 .. 89 93 .. 86 103 .. 0.47
3 ? -2.8 0.1 0.29 0.29 6 14 .. 120 129 .. 116 131 .. 0.48
Alignments for each domain:
== domain 1 score: 49.6 bits; conditional E-value: 1.2e-17
DUF1648 1 llillplvlglilypkLPdqiPtHfnasGepDgygsKlfglfllPllll 49
++il+++ ++++lyp LP+++++Hf+ + pD ++ K+ gl+l+P+l++
WP_003726112.1 10 MIILFTVGISAVLYPLLPSEVAVHFGTDFSPDMFMQKWLGLILIPFLMI 58
59*********************************************96 PP
== domain 2 score: -3.6 bits; conditional E-value: 0.5
DUF1648 4 llplv 8
ll+++
WP_003726112.1 89 LLTII 93
44433 PP
== domain 3 score: -2.8 bits; conditional E-value: 0.29
DUF1648 6 plvlgli.ly 14
++v++++ y
WP_003726112.1 120 MFVVAAYiQY 129
4444443255 PP
Or compare WP_003726112.1 to CDD or PaperBLAST