WP_013483669.1 has 231 amino acids
Query: DUF1648 [M=49]
Accession: PF07853.15
Description: Domain of unknown function (DUF1648)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6e-20 57.0 0.4 6e-20 57.0 0.4 2.2 2 WP_013483669.1
Domain annotation for each sequence (and alignments):
>> WP_013483669.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 57.0 0.4 6e-20 6e-20 2 49 .] 8 54 .. 7 54 .. 0.97
2 ? -3.5 0.3 0.48 0.48 8 14 .. 132 138 .. 130 140 .. 0.45
Alignments for each domain:
== domain 1 score: 57.0 bits; conditional E-value: 6e-20
DUF1648 2 lillplvlglilypkLPdqiPtHfnasGepDgygsKlfglfllPllll 49
++l+pl+++ ++ ++LP+++P+H+na+Ge+D++gs+ +++f+ P+++l
WP_013483669.1 8 IALFPLMATTAAVNFLPEKVPIHYNAAGEADSWGSR-NFCFIYPIIIL 54
899*********************************.*********86 PP
== domain 2 score: -3.5 bits; conditional E-value: 0.48
DUF1648 8 vlglily 14
++gli+
WP_013483669.1 132 IFGLIFI 138
4444443 PP
Or compare WP_013483669.1 to CDD or PaperBLAST