WP_103118925.1 has 164 amino acids
Query: DUF1648 [M=49]
Accession: PF07853.15
Description: Domain of unknown function (DUF1648)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.1e-22 63.0 0.6 8.1e-22 63.0 0.6 2.2 2 WP_103118925.1
Domain annotation for each sequence (and alignments):
>> WP_103118925.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 63.0 0.6 8.1e-22 8.1e-22 2 49 .] 24 70 .. 23 70 .. 0.97
2 ? -2.0 0.7 0.16 0.16 42 48 .. 140 146 .. 136 154 .. 0.69
Alignments for each domain:
== domain 1 score: 63.0 bits; conditional E-value: 8.1e-22
DUF1648 2 lillplvlglilypkLPdqiPtHfnasGepDgygsKlfglfllPllll 49
+++l++++++++++kLPd+iP Hfn Ge+D++gsK ++lf+lP+++l
WP_103118925.1 24 IFILSIFYIILAWGKLPDEIPGHFNGLGEVDRWGSK-IELFILPFIGL 70
79**********************************.********975 PP
== domain 2 score: -2.0 bits; conditional E-value: 0.16
DUF1648 42 fllPlll 48
++lP++l
WP_103118925.1 140 WFLPIVL 146
6666665 PP
Or compare WP_103118925.1 to CDD or PaperBLAST