VIMSS58831 has 80 amino acids
Query: DUF1654 [M=70]
Accession: PF07867.15
Description: Protein of unknown function (DUF1654)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6e-36 108.4 0.1 6.7e-36 108.2 0.1 1.0 1 VIMSS58831
Domain annotation for each sequence (and alignments):
>> VIMSS58831
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 108.2 0.1 6.7e-36 6.7e-36 1 67 [. 12 78 .. 12 80 .] 0.98
Alignments for each domain:
== domain 1 score: 108.2 bits; conditional E-value: 6.7e-36
DUF1654 1 tsyerlgaRvqriinaPaaQksrvavvlrlegeseedWarlleelaeteevelafqdDgsvrvrWer 67
t+y++l++R+qrii+aPaaQ++++a+++rl+ge+e+dWa+lle++++++++ l++q+Dgs+++rW++
VIMSS58831 12 TAYDLLNTRIQRIIHAPAAQQACQACISRLPGEDEGDWAHLLESFDRSNQWLLDPQRDGSIVLRWSS 78
79***************************************************************97 PP
Or compare VIMSS58831 to CDD or PaperBLAST