VIMSS58831 has 80 amino acids
Query: DUF1654 [M=70] Accession: PF07867.15 Description: Protein of unknown function (DUF1654) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-36 108.4 0.1 6.7e-36 108.2 0.1 1.0 1 VIMSS58831 Domain annotation for each sequence (and alignments): >> VIMSS58831 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 108.2 0.1 6.7e-36 6.7e-36 1 67 [. 12 78 .. 12 80 .] 0.98 Alignments for each domain: == domain 1 score: 108.2 bits; conditional E-value: 6.7e-36 DUF1654 1 tsyerlgaRvqriinaPaaQksrvavvlrlegeseedWarlleelaeteevelafqdDgsvrvrWer 67 t+y++l++R+qrii+aPaaQ++++a+++rl+ge+e+dWa+lle++++++++ l++q+Dgs+++rW++ VIMSS58831 12 TAYDLLNTRIQRIIHAPAAQQACQACISRLPGEDEGDWAHLLESFDRSNQWLLDPQRDGSIVLRWSS 78 79***************************************************************97 PP
Or compare VIMSS58831 to CDD or PaperBLAST