VIMSS878990 has 94 amino acids
Query: DUF1654 [M=70]
Accession: PF07867.15
Description: Protein of unknown function (DUF1654)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.3e-39 119.3 0.2 2.9e-39 119.0 0.2 1.1 1 VIMSS878990
Domain annotation for each sequence (and alignments):
>> VIMSS878990
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 119.0 0.2 2.9e-39 2.9e-39 2 70 .] 25 93 .. 24 93 .. 0.98
Alignments for each domain:
== domain 1 score: 119.0 bits; conditional E-value: 2.9e-39
DUF1654 2 syerlgaRvqriinaPaaQksrvavvlrlegeseedWarlleelaeteevelafqdDgsvrvrWerple 70
+yer+g+Rvq+iin+P+aQksr+a+++r+++ese+dWa+llee+ae+++v+la++dDg+v+++W+ p+e
VIMSS878990 25 PYERMGMRVQKIINSPTAQKSRAALLFRQPDESEDDWAQLLEEIAENDNVTLAWRDDGGVQIFWTLPKE 93
7****************************************************************9976 PP
Or compare VIMSS878990 to CDD or PaperBLAST