VIMSS255443 has 72 amino acids
Query: DUF1656 [M=56]
Accession: PF07869.16
Description: Protein of unknown function (DUF1656)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.4e-26 77.9 6.7 3.1e-26 77.5 6.7 1.2 1 VIMSS255443
Domain annotation for each sequence (and alignments):
>> VIMSS255443
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 77.5 6.7 3.1e-26 3.1e-26 1 56 [] 7 62 .. 7 62 .. 0.98
Alignments for each domain:
== domain 1 score: 77.5 bits; conditional E-value: 3.1e-26
DUF1656 1 EidlgGvyvppllvlallAlvltlllrrllarlglyrlvWhpaLfdlalfvcllgl 56
E++l+Gv+vp+ll+l+ lA++l ++ +ll+r+g+yr++WhpaLf+lal++ llg+
VIMSS255443 7 EFSLYGVFVPTLLALMTLAYLLNSAVGALLTRAGAYRHIWHPALFNLALYIALLGG 62
89***************************************************995 PP
Or compare VIMSS255443 to CDD or PaperBLAST