VIMSS57681 has 65 amino acids
Query: DUF1656 [M=56]
Accession: PF07869.16
Description: Protein of unknown function (DUF1656)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.3e-16 44.7 9.4 6.5e-16 44.5 9.4 1.1 1 VIMSS57681
Domain annotation for each sequence (and alignments):
>> VIMSS57681
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 44.5 9.4 6.5e-16 6.5e-16 1 55 [. 7 59 .. 7 60 .. 0.97
Alignments for each domain:
== domain 1 score: 44.5 bits; conditional E-value: 6.5e-16
DUF1656 1 EidlgGvyvppllvlallAlvltlllrrllarlglyrlvWhpaLfdlalfvcllg 55
E+++ G+yvppl+++++lA+ l+lll rl +r + ++ Whp+L+++ l +++l+
VIMSS57681 7 EVSVSGLYVPPLFLYLCLAMPLYLLLERLAWR--WLECAWHPGLLRFFLSFIVLS 59
899**************************998..9******************97 PP
Or compare VIMSS57681 to CDD or PaperBLAST