PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS75602 to PF07869 (DUF1656)

VIMSS75602 has 67 amino acids

Query:       DUF1656  [M=56]
Accession:   PF07869.16
Description: Protein of unknown function (DUF1656)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    6.3e-23   66.9  11.0    7.5e-23   66.7  11.0    1.1  1  VIMSS75602  


Domain annotation for each sequence (and alignments):
>> VIMSS75602  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   66.7  11.0   7.5e-23   7.5e-23       2      56 .]       7      61 ..       6      61 .. 0.97

  Alignments for each domain:
  == domain 1  score: 66.7 bits;  conditional E-value: 7.5e-23
     DUF1656  2 idlgGvyvppllvlallAlvltlllrrllarlglyrlvWhpaLfdlalfvcllgl 56
                i ++G+ +pp+++ +ll+l++++l+ r+l  +g+y +vWhpaLf++al++cl++l
  VIMSS75602  7 IVVFGLSFPPIFFELLLSLAIFWLVCRVLVPTGIYDFVWHPALFNTALYCCLFYL 61
                889*************************************************986 PP



Or compare VIMSS75602 to CDD or PaperBLAST